IP range details

93.189.40.0/21

AS41853  ·  Limited Liability Company NTCOM

Need more data or want to access it via API or data downloads? Sign up to get free access

Sign up for free ›

Summary

Country Russia
Domain nt-com.ru
ASN AS41853
Registry ripe
Hosted IPs 2,048
ID RU-NTCOM-20080428

WHOIS Details

inetnum:        93.189.40.0 - 93.189.47.255
netname:        RU-NTCOM-20080428
country:        RU
org:            ORG-LLCN3-RIPE
admin-c:        IA759-RIPE
tech-c:         PA3391-RIPE
status:         ALLOCATED PA
mnt-by:         RIPE-NCC-HM-MNT
mnt-by:         NT-COM-MNT
mnt-routes:     NT-COM-MNT
mnt-routes:     MNT-KV
notify:         ncc@nt-com.ru
notify:         mikhail@m-ix.ru
created:        2008-04-24T11:14:45Z
last-modified:  2023-08-21T12:50:30Z
source:         RIPE
descr:          LTD NTCOM
abuse-email:    abuse@nt-vps.ru
abuse-c:        AR16832-RIPE
abuse-org:      ORG-LLCN3-RIPE

organisation:   ORG-LLCN3-RIPE
org-name:       Limited Liability Company NTCOM
country:        RU
org-type:       LIR
address:        23/3 Bolshaya Novodmitrovskaya
address:        127015
address:        MOSCOW
address:        RUSSIAN FEDERATION
phone:          +7 4957482035
fax-no:         +7 4957480343
e-mail:         ncc@nt-com.ru
abuse-c:        AR16832-RIPE
admin-c:        RK7187-RIPE
mnt-ref:        NT-COM-MNT
mnt-ref:        RIPE-NCC-HM-MNT
mnt-by:         RIPE-NCC-HM-MNT
mnt-by:         NT-COM-MNT
created:        2006-10-30T06:11:06Z
last-modified:  2022-03-16T10:44:43Z
source:         RIPE

person:         Georgiy Pankov
address:        12/15 Bolshaya Novodmitrovskaya Street, 127015, Moscow, Russian Federation
phone:          +7 (495) 748-20-35
e-mail:         ncc@nt-com.ru
nic-hdl:        IA759-RIPE
notify:         ncc@nt-com.ru
mnt-by:         NT-COM-MNT
created:        2006-09-29T13:26:00Z
last-modified:  2020-06-10T08:46:38Z
source:         RIPE

person:         Ivan Nesterov
address:        12/15 Bolshaya Novodmitrovskaya Street, 127015, Moscow, Russian Federation
phone:          +7 (495) 748-20-35
e-mail:         i.nesterov@nt-vps.ru
nic-hdl:        PA3391-RIPE
notify:         ncc@nt-com.ru
mnt-by:         NT-COM-MNT
created:        2007-01-29T14:59:38Z
last-modified:  2020-03-20T06:50:25Z
source:         RIPE

route:          93.189.40.0/21
descr:          NTCOM-NET
origin:         AS41853
mnt-by:         NT-COM-MNT
mnt-by:         MNT-KV
notify:         ncc@nt-com.ru
notify:         mikhail@m-ix.ru
created:        2008-12-17T14:48:04Z
last-modified:  2023-08-21T12:44:09Z
source:         RIPE

Hosted domains

There are 283 domain names hosted across 105 IP addresses on this ASN. Checkout our API to access full domain hosting information.

IP Address Domain Domains on this IP
93.189.42.40 xn--90aisfq9e.xn--p1ai 114
93.189.41.191 ivanpozhidaev.ru 16
93.189.42.141 rzvvk.ru 10
93.189.42.156 looksfine.ru 7
93.189.42.45 limuzin-spb.ru 5
93.189.43.107 golos-hrama.ru 5
93.189.42.137 tver.today 5
93.189.45.39 xn-----6kcd9bfufa1aejcnk.xn--p1ai 4
93.189.47.100 norsi-trans.com 4
93.189.40.24 xn----7sbbrb2aiqcl6ab1a7hhg.xn--p1ai 4
93.189.40.100 vkonakovo.ru 4
93.189.43.157 xn--b1aahtdcklaebqrcmt.xn--p1ai 4
93.189.47.20 yakhont-shd.ru 3
93.189.47.127 ffyou.ru 3
93.189.40.27 megasnack.uz 2
93.189.40.197 vnz-nasos.ru 2
93.189.40.40 fx777fx.com 2
93.189.40.238 1vp.ru 2
93.189.45.241 buyers-network.com 1
93.189.46.12 familyfriendlyreviewsandgiveaways.com 1

Hosted domains API

Our Hosted Domains API, or Reverse IP API returns a full list of domains that are hosted on a single IP address.
Useful for Cybersecurity

What are IP address ranges?

IP address ranges, or netblocks, are groups of related IP addresses. They are usually represented as a base IP address, followed by a slash, and then a netmask which represents how many IP addresses are contained within the netblock. This format is known as CIDR. You'll also sometimes see netblocks given as a start ip address, and an end ip address, or an ip address range.

Traffic works its way around the internet based on the routing table, which contains a list of networks and their associated netblocks.

An API built with users in mind: reliable, accurate, and easy-to-use

Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.

IPinfo for all your IP geolocation needs

Our IP tools

Explore all tools
What is my IP

What is my IP

Test our data accuracy by viewing insights from your IP address.

See your IP address
Map IPs

Map IPs

Paste up to 500,000 IPs to see where they're located on a map.

Try Map IPs
Summarize IPs

Summarize IPs

Use our data visualization tool to create a visual overview of multiple IPs.

Try Summarize IPs